| Title | Crystal structure of negative cofactor 2 recognizing the TBP-DNA transcription complex. Cell(Cambridge,Mass.) 106 71-81 2001 | | Site | NYSGXRC | | PDB Id | | Target Id | NYSGXRC-P048a | | Molecular Characteristics | | Source | Homo sapiens | | Alias Ids | TPS8068,Q14919 | Molecular Weight | 22348.63 Da. | | Residues | 205 | Isoelectric Point | 5.04 | | Sequence | mpskkkkynarfpparikkimqtdeeigkvaaavpviisralelflesllkkacqvtqsrnaktmttsh lkqcieleqqfdflkdlvasvpdmqgdgednhmdgdkgarrgrkpgsggrknggmgtkskdkklsgtds eqedesedtdtdgeeetsqpppqashpsahfqspptpflpfastlplppappgpsapdeedeedyds | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.62 | Rfree | 0.2770000 | | Matthews' coefficent | 2.79 | Rfactor | 0.2330000 | | Waters | 9 | Solvent Content | 55.84 |
| Ligand Information | | Ligands | | | Metals | | | |
