.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jd1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title X-ray structure of Saccharomyces cerevisiae homologous mitochondrial matrix factor 1 (Hmf1). Proteins 48 431-436 2002
    Site NYSGXRC
    PDB Id 1jd1 Target Id NYSGXRC-P003
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8058,P40037 Molecular Weight 13905.16 Da.
    Residues 129 Isoelectric Point 5.28
    Sequence mvttltpvicesapaaaasyshamkvnnliflsgqipvtpdnklvegsiadkaeqviqniknvleasns sldrvvkvnifladinhfaefnsvyakyfnthkparscvavaalplgvdmemeaiaaerd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.70 Rfree 0.238
    Matthews' coefficent 2.42 Rfactor 0.207
    Waters 634 Solvent Content 49.27

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch