.
The Open Protein Structure Annotation Network
PDB Keyword
.

1i9a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structural genomics of enzymes involved in sterol/isoprenoid biosynthesis. Proc.Natl.Acad.Sci.USA 98 12896-12901 2001
    Site NYSGXRC
    PDB Id 1i9a Target Id NYSGXRC-P109a
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8078,Q46822 Molecular Weight 20507.18 Da.
    Residues 182 Isoelectric Point 5.94
    Sequence mqtehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwtnsvcgh pqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaarttsalqinddevmd yqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.2790000
    Matthews' coefficent 3.26 Rfactor 0.2290000
    Waters 261 Solvent Content 62.31

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch