.
The Open Protein Structure Annotation Network
PDB Keyword
.

1g61

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structures of ribosome anti-association factor IF6. Nat.Struct.Biol. 7 1156-1164 2000
    Site NYSGXRC
    PDB Id 1g61 Target Id NYSGXRC-P111a
    Molecular Characteristics
    Source Methanococcus jannaschii.
    Alias Ids TPS8080,Q60357 Molecular Weight 24457.80 Da.
    Residues 228 Isoelectric Point 4.53
    Sequence mtmiirkyfsgiptigvlaltteeitllpifldkddvnevsevletkclqtniggsslvgslsvankyg lllpkivedeeldriknflkennldlnveiikskntalgnliltndkgalispelkdfkkdiedslnve veigtiaelptvgsnavvtnkgclthplveddeleflkslfkveyigkgtankgttsvgaciianskga vvggdttgpelliiedalgli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.30 Rfree 0.1790000
    Matthews' coefficent 2.37 Rfactor 0.1320000
    Waters 704 Solvent Content 48.06

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch