.
The Open Protein Structure Annotation Network
PDB Keyword
.

1f89

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of a putative CN hydrolase from yeast. Proteins 52 283-291 2003
    Site NYSGXRC
    PDB Id 1f89 Target Id NYSGXRC-P018
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8063,P49954 Molecular Weight 32547.48 Da.
    Residues 291 Isoelectric Point 7.09
    Sequence msaskilsqkikvalvqlsgsspdkmanlqraatfieramkeqpdtklvvlpecfnspystdqfrkyse vinpkepstsvqflsnlankfkiilvggtipeldpktdkiyntsiifnedgklidkhrkvhlfdvdipn gisfhesetlspgeksttidtkygkfgvgicydmrfpelamlsarkgafamiypsafntvtgplhwhll arsravdnqvyvmlcsparnlqssyhayghsivvdprgkivaeagegeeiiyaeldpeviesfrqavpl tkqrrfdvysdvnah
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.258
    Matthews' coefficent 2.26 Rfactor 0.229
    Waters 117 Solvent Content 49.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch