.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ci0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title The Structure of PNP Oxidase from S. Cerevisiae. To be Published
    Site NYSGXRC
    PDB Id 1ci0 Target Id NYSGXRC-P008
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8062,P38075 Molecular Weight 26906.88 Da.
    Residues 228 Isoelectric Point 6.94
    Sequence mtkqaeetqkpiifapetyqydkftlnekqltddpidlftkwfneakedpretlpeaitfssaelpsgr vssrillfkeldhrgftiysnwgtsrkahdiatnpnaaivffwkdlqrqvrvegitehvnretseryfk trprgskigawasrqsdviknreeldeltqknterfkdaedipcpdywgglrivpleiefwqgrpsrlh drfvyrrktendpwkvvrlap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.2740000
    Matthews' coefficent 2.40 Rfactor 0.2250000
    Waters 32 Solvent Content 48.00

    Ligand Information
    Ligands FMN (FLAVIN) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch