.
The Open Protein Structure Annotation Network
PDB Keyword
.

1b54

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of a yeast hypothetical protein selected by a structural genomics approach. Acta Crystallogr.,Sect.D 59 127-135 2003
    Site NYSGXRC
    PDB Id 1b54 Target Id NYSGXRC-P007
    Related PDB Ids 1ct5 
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS8060,P38197 Molecular Weight 29121.68 Da.
    Residues 257 Isoelectric Point 6.03
    Sequence mstgitydedrktqliaqyesvrevvnaeaknvhvnenaskilllvvsklkpasdiqilydhgvrefge nyvqeliekakllpddikwhfigglqtnkckdlakvpnlysvetidslkkakklnesrakfqpdcnpil cnvqintshedqksglnneaeifevidfflseeckyiklnglmtigswnvshedskenrdfatlvewkk kidakfgtslklsmgmsadfreairqgtaevrigtdifgarppknearii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.3030000
    Matthews' coefficent 2.50 Rfactor 0.2350000
    Waters 162 Solvent Content 52.00

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch