| Title | Structure of the snake-venom toxin convulxin. Acta Crystallogr.,Sect.D 60 46-53 2004 | | Site | SPINE | | PDB Id | 1uos | Target Id | OX_CVX | | Molecular Characteristics | | Source | Crotalus durissus terrificus | | Alias Ids | 38493075, | Molecular Weight | 30721.15 Da. | | Residues | 261 | Isoelectric Point | 6.07 | | Sequence | glhcpsdwyyydqhcyrifneemnwedaewfctkqakgahlvsiksakeadfvawmvtqnieesfshvsi glrvqnkekqcstkwsdgssvsydnlldlyitkcsllkketgfrkwfvascigkipfvckfppqcagfc cpshwssydrycykvfkqemtwadaekfctqqhtgshlvsfhsteevdfvvkmthqslkstffwigann iwnkcnwqwsdgtkpeykewheefeclisrtfdnqwlsapcsdtysfvckfea | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.70 | Rfree | 0.263 | | Matthews' coefficent | 4.02 | Rfactor | 0.235 | | Waters | 320 | Solvent Content | 71.00 |
| Ligand Information | | Ligands | | | Metals | | | |
