| Title | Structure of a conserved hypothetical protein, TTHA0849 from Thermus thermophilus HB8, at 2.4 A resolution: a putative member of the StAR-related lipid-transfer (START) domain superfamily. Acta Crystallogr.,Sect.F 61 1027-1031 2005 | | Site | RSGI | | PDB Id | 2d4r | Target Id | ttk003001201.1 | | Molecular Characteristics | | Source | Thermus thermophilus | | Alias Ids | | Molecular Weight | 17083.72 Da. | | Residues | 147 | Isoelectric Point | 5.16 | | Sequence | mpevraeryipappervyrlakdleglkpylkeveslevvaregartrsrwvavamgkkvrwleeeewdd enlrnrffspegdfdryegtwvflpegegtrvvltltyeltipifggllrklvqklmqenvesllkgle ervlaass | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.40 | Rfree | 0.299 | | Matthews' coefficent | 1.93 | Rfactor | 0.223 | | Waters | 376 | Solvent Content | 36.35 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 1 | | Metals | | | |
