| Title | Substrate Recognition and Molecular Mechanism of Fatty Acid Hydroxylation by Cytochrome P450 from Bacillus subtilis. CRYSTALLOGRAPHIC, SPECTROSCOPIC, AND MUTATIONAL STUDIES. J.Biol.Chem. 278 9761-9767 2003 | | Site | RSGI | | PDB Id | 1izo | Target Id | my_001000031.1 | | Molecular Characteristics | | Source | Bacillus subtilis | | Alias Ids | | Molecular Weight | 48106.62 Da. | | Residues | 417 | Isoelectric Point | 6.45 | | Sequence | mneqiphdksldnsltllkegylfiknrterynsdlfqarllgknficmtgaeaakvfydtdrfqrqnal pkrvqkslfgvnaiqgmdgsahihrkmlflslmtpphqkrlaelmteewkaavtrwekadevvlfeeak eilcrvacywagvplketevkeraddfidmvdafgavgprhwkgrrarpraeewievmiedaragllkt tsgtalhemafhtqedgsqldsrmaaielinvlrpivaisyflvfsalalhehpkykewlrsgnsrere mfvqevrryypfgpflgalvkkdfvwnncefkkgtsvlldlygtnhdprlwdhpdefrperfaereenl fdmipqggghaekghrcpgegitievmkasldflvhqieydvpeqslhyslarmpslpesgfvmsgirrks | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 3 | | Resolution (Å) | 2.10 | Rfree | 0.28 | | Matthews' coefficent | 2.67 | Rfactor | 0.246 | | Waters | 295 | Solvent Content | 53.54 |
| Ligand Information | | Ligands | HEM (PROTOPORPHYRIN) x 3;PAM (PALMITOLEIC) x 3 | | Metals | | | |
