.
The Open Protein Structure Annotation Network
.
TOPSAN > Proteins > RSGI > 1iub
Table of contents
  1. 1. Protein Summary
  2. 2. Ligand Summary

Title Crystal Structure of Fucose-Specific Lectin from Aleuria aurantia Binding Ligands at Three of Its Five Sugar Recognition Sites. Biochemistry 42 11093-11099 2003
Site RSGI
PDB Id 1iub Target Id my_001000040.2
Molecular Characteristics
Source Aleuria aurantia
Alias Ids Molecular Weight 33396.40 Da.
Residues 312 Isoelectric Point 9.33
Sequence pteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklfsplaavtwks aqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqwggsesappnirvyyqksng sgssiheyvwsgkwtagasfgstvpgtgigataigpgrlriyyqatdnkirehcwdsnswyvggfsasa sagvsiaaiswgstpnirvywqkgreelyeaayggswntpgqikdasrptpslpdtfiaanssgnidis vffqasgvslqqwqwisgkgwsigavvptgtpagw
  BLAST   FFAS   ProFunc   GPSS

Structure Determination
Method XRAY Chains 1
Resolution (Å) 2.31 Rfree 0.183
Matthews' coefficent 3.86 Rfactor 0.156
Waters 114 Solvent Content 68.15

Ligand Information
Ligands FUL (BETA-L-FUCOSE) x 2;SO4 (SULFATE) x 1
Metals CL (CHLORIDE) x 2;HG (MERCURY) x 2

Jmol

 

Protein Summary


Ligand Summary

Reviews

References

 

No references found.

Classification

Classification

Tag page

Files (0)

 
You must login to post a comment.
All content on this site is licensed under a Creative Commons Attribution 3.0 License

Powered by MindTouch Deki v.8.08