| Title | Binding Hot Spots in the TEM1-BLIP Interface in Light of its Modular Architecture. J.Mol.Biol. 102 57-62 2006 | | Site | ISPC | | PDB Id | 2b5r | Target Id | W00364 | | Molecular Characteristics | | Source | Streptomyces calvalugarus | | Alias Ids | P35804, P00810, | Molecular Weight | 17316.33 Da. | | Residues | 165 | Isoelectric Point | 5.46 | | Sequence | agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgftsaaadakvdsk sqeallapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypaypstagvtlslscfdvdgyss tgaargsahlwftdgvlqgkrqwdlv | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.65 | Rfree | 0.222 | | Matthews' coefficent | 2.27 | Rfactor | 0.19 | | Waters | 525 | Solvent Content | 46.00 |
| Ligand Information | | Ligands | | | Metals | | | |
