.
The Open Protein Structure Annotation Network
.
TOPSAN > Proteins > ISPC > 1y7w
Table of contents
  1. 1. Protein Summary
  2. 2. Ligand Summary

Title Three-dimensional structure of a halotolerant algal carbonic anhydrase predicts halotolerance of a mammalian homolog. Proc.Natl.Acad.Sci.Usa 102 7493-7498 2005
Site ISPC
PDB Id 1y7w Target Id W00565
Molecular Characteristics
Source Green alga dunaliella salina
Alias Ids Molecular Weight 31675.61 Da.
Residues 291 Isoelectric Point 4.74
Sequence masmtggqqmgrgseepnpndgydymqhgfdwpglqeggttkypacsgsnqspidintnqlmepssrsgt savslnglnvdgaqadgitltnakvdleqgmkvtfdqpaanlptieiggttksfvpiqfhfhhflseht ingihyplelhivmqeqdpadvataqlavigimykysengdaflnslqtqiegkigdgtasygdtgvsi dninvktqllpsslkyagydgslttpgcdervkwhvfttprevtreqmklfvdvtmgahagadvvnnrm iqdlgdrevykyny
  BLAST   FFAS   ProFunc   GPSS

Structure Determination
Method XRAY Chains 2
Resolution (Å) 1.86 Rfree 0.202
Matthews' coefficent 2.65 Rfactor 0.167
Waters 527 Solvent Content 52.70

Ligand Information
Ligands ACY (ACETIC) x 2
Metals NA (SODIUM) x 2;ZN (ZINC) x 3

Jmol

 

Protein Summary


Ligand Summary

Reviews

References

 

No references found.

Classification

Classification

Tag page

Files (0)

 
You must login to post a comment.
All content on this site is licensed under a Creative Commons Attribution 3.0 License

Powered by MindTouch Deki v.8.08