| Title | The modular architecture of protein-protein binding interfaces. Proc.Natl.Acad.Sci.USA 102 57-62 2005 | | Site | ISPC | | PDB Id | 1xxm | Target Id | W00178 | | Molecular Characteristics | | Source | Streptomyces calvalugarus | | Alias Ids | P35804, P00810, | Molecular Weight | 17316.33 Da. | | Residues | 165 | Isoelectric Point | 5.46 | | Sequence | agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgftsaaadakvdsk sqeallapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypaypstagvtlslscfdvdgyss tgaargsahlwftdgvlqgkrqwdlv | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.90 | Rfree | 0.247 | | Matthews' coefficent | 2.30 | Rfactor | 0.219 | | Waters | 417 | Solvent Content | 46.50 |
| Ligand Information | | Ligands | | | Metals | CA (CALCIUM) x 2 | | |
