| Title | Crystal structure of the A1KSW9_NEIMF protein from Neisseria meningitidis. To be Published | | Site | NESGC | | PDB Id | | Target Id | MR36A | | Molecular Characteristics | | Source | Neisseria meningitidis | | Alias Ids | TPS8961,PF04390, 3.30.160.150 | Molecular Weight | 15989.40 Da. | | Residues | 144 | Isoelectric Point | 5.47 | | Sequence | mgfhlkgadgisppltyrswhieggqalqfpletalyqasgrvddaagaqmtlridsvsqnketytvtr aavineylliltveaqvlkrgepvgkpmtvsvrrvlayadneilgkqeeeaalwaemrqdaaeqivrrl tflkae | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.60 | Rfree | 0.258 | | Matthews' coefficent | 2.84 | Rfactor | 0.226 | | Waters | 38 | Solvent Content | 56.75 |
| Ligand Information | | Ligands | | | Metals | | | |