| Title | X-Ray structure of the NHN endonuclease from Geobacter metallireducens. To be Published | | Site | NESGC | | PDB Id | | Target Id | GmR87 | | Molecular Characteristics | | Source | Geobacter metallireducens | | Alias Ids | TPS8899,PF01844, BIG_704 | Molecular Weight | 12198.25 Da. | | Residues | 104 | Isoelectric Point | 5.76 | | Sequence | mnyfivevseqevkrekekarelrrsqwwknriargichycgeifppeeltmdhlvpvvrggkstrgnv vpackecnnrkkyllpveweeyldslesepsdgeg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.60 | Rfree | 0.2964 | | Matthews' coefficent | 2.35 | Rfactor | 0.2348 | | Waters | 15 | Solvent Content | 47.73 |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 3 | | |
