| Title | Crystal structure of the probable amino-acid ABC transporter extracellular-binding protein ytmK from Bacillus subtilis. Northeast Structural Genomics Consortium target SR572. To be Published | | Site | NESGC | | PDB Id | | Target Id | SR572 | | Molecular Characteristics | | Source | Bacillus subtilis | | Alias Ids | TPS9109,PF00497, 3.40.190.10, PF09084 | Molecular Weight | 28098.43 Da. | | Residues | 250 | Isoelectric Point | 8.40 | | Sequence | mgagsqttgagqkkvqtitvgtgtqfpnicfidekgdltgydvelikeldkrlphykftfktmefsnll vslgqhkvdivahqmekskerekkflfnkvaynhfplkitvlqnndtirgiedlkgkrvitsatsngal vlkkwnedngrpfeiayegqganetanqlksgradatistpfavdfqnktstikektvgnvlsnakvyf mfnkneqtlsddidkalqeiiddgtlkrlslkwlgddyskeqy | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.264 | | Matthews' coefficent | 2.37 | Rfactor | 0.23 | | Waters | 301 | Solvent Content | 47.99 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 4 | | Metals | | | |
