| Title | Structure and function of the phenazine biosynthetic protein PhzF from Pseudomonas fluorescens. Proc.Natl.Acad.Sci.Usa 101 16431-16436 2004 | | Site | NESGC | | PDB Id | 1sdj | Target Id | ET25 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | 3.10.310.10, | Molecular Weight | 32317.09 Da. | | Residues | 297 | Isoelectric Point | 5.84 | | Sequence | mkpqvyhvdaftsqpfrgnsagvvfpadnlseaqmqliarelghsetafllhsddsdvriryftptvevp icghatvaahyvrakvlglgnctiwqtslagkhrvtiekhnddyrisleqgtpgfepplegetraaiin alhlteddilpglpiqvattghskvmiplkpevdidalspdlnaltaiskkigcngffpfqirpgknet dgrmfspaigivedpvtgnangpmgawlvhhnvlphdgnvlrvkghqgralgrdgmievtvtirdnqpe kvtisgtavilfhaewaiel | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.30 | Rfree | 0.26 | | Matthews' coefficent | 2.91 | Rfactor | 0.218 | | Waters | 144 | Solvent Content | 57.73 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 5 | | Metals | | | |
