| Title | Solution Structure Of The Hypothetical Protein PF0455 From Pyrococcus furiosus: Northeast Structural Genomics Consortium Target PfR13. To be Published | | Site | NESGC | | PDB Id | 1s04 | Target Id | PfR13 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | 3.10.480.10, 6045, | Molecular Weight | 13155.68 Da. | | Residues | 110 | Isoelectric Point | 6.43 | | Sequence | mewemglqeefleliklrkkkiegrlydekrrqikpgdvisfeggklkvrvkairvynsfremlekegle nvlpgvksieegiqvyrrfydeekekkygvvaieiepley | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
