| Title | Solution structure of Archaeglobus fulgidis peptidyl-tRNA hydrolase (Pth2) provides evidence for an extensive conserved family of Pth2 enzymes in archea, bacteria, and eukaryotes. Protein Sci. 14 2849-2861 2005 | | Site | NESGC | | PDB Id | 1rzw | Target Id | GR4 | | Related PDB Ids 3erj | | Molecular Characteristics | | Source | Archaeoglobus fulgidus | | Alias Ids | 3.40.1490.10, 6058, | Molecular Weight | 12486.12 Da. | | Residues | 115 | Isoelectric Point | 9.56 | | Sequence | mtlkqvivvrddlklsrgklavqvahaaiigylksdsslrrkwldegqkkvvlkvksleellgikhkaes lglvtglvqdagltevppgtitavvigpdeerkidkvtgnlpllk | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
