| Title | The 2.35 A structure of the TenA homolog from Pyrococcus furiosus supports an enzymatic function in thiamine metabolism. Acta Crystallogr.,Sect.D 61 589-598 2005 | | Site | NESGC | | PDB Id | 1rtw | Target Id | PfR34 | | Molecular Characteristics | | Source | Pyrococcus furiosus | | Alias Ids | 1.20.910.10, | Molecular Weight | 25422.77 Da. | | Residues | 212 | Isoelectric Point | 5.18 | | Sequence | mfseelikeneniwrrflphkfliemaentikkenfekwlvndyyfvknalrfmallmakapddllpffa esiyyiskelemfekkaqelgislngeidwraksyvnyllsvaslgsflegftalyceekayyeawkwv renlkerspyqefinhwssqefgeyvkriekilnslaekhgefekerarevfkevskfelifwdiaygg egnv | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.35 | Rfree | 0.281 | | Matthews' coefficent | 2.40 | Rfactor | 0.24 | | Waters | 234 | Solvent Content | 48.67 |
| Ligand Information | | Ligands | PO4 (PHOSPHATE) x 3;MP5 ((4-AMINO-2-METHYLPYRIMIDIN-5-YL)METHYL) x 1 | | Metals | | | |
