| Title | Solution NMR structure of the iron-sulfur cluster assembly protein U (IscU) with zinc bound at the active site. J.Mol.Biol. 344 567-583 2004 | | Site | NESGC | | PDB Id | 1r9p | Target Id | IR24 | | Related PDB Ids 1q48 | | Molecular Characteristics | | Source | Haemophilus influenzae | | Alias Ids | 3.90.1010.10, 5842, | Molecular Weight | 13398.46 Da. | | Residues | 126 | Isoelectric Point | 4.99 | | Sequence | maysekvidhyenprnvgsldkkdsnvgtgmvgapacgdvmqlqikvddngiiedakfktygcgsaiass slitewvkgksleeagaiknsqiaeelelppvkvhcsilaedaikaaiadykakqg | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 1 | | |
