| Title | Structure of an acetyl-CoA binding protein from Staphylococcus aureus representing a novel subfamily of GCN5-related N-acetyltransferase-like proteins. J.Struct.Funct.Genom. 2008 | | Site | NESGC | | PDB Id | 1r57 | Target Id | ZR31 | | Related PDB Ids 2h5m | | Molecular Characteristics | | Source | Staphylococcus aureus | | Alias Ids | 3.40.630.30, 5845, | Molecular Weight | 10579.27 Da. | | Residues | 94 | Isoelectric Point | 5.07 | | Sequence | msnleikqgenkfyigddenhalaeityrfvdnneinidhtgvsdelggqgvgkklvkavveharenhlk iiascsfakhmlekedsyqdvylg | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
