| Title | The NMR solution structure of the 30S ribosomal protein S27e encoded in gene RS27_ARCFU of Archaeoglobus fulgidis reveals a novel protein fold. Protein Sci. 13 1407-1416 2004 | | Site | NESGC | | PDB Id | 1qxf | Target Id | GR2 | | Molecular Characteristics | | Source | Archaeoglobus fulgidus | | Alias Ids | 5682, | Molecular Weight | 6513.22 Da. | | Residues | 58 | Isoelectric Point | 5.85 | | Sequence | mhsrfvkvkcpdceheqvifdhpstivkciicgrtvaeptggkgnikaeiieyvdqie | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
