| Title | NMR structure of the hypothetical protein NMA1147 from Neisseria meningitidis reveals a distinct 5-helix bundle. Proteins 55 756-758 2004 | | Site | NESGC | | PDB Id | 1puz | Target Id | MR19 | | Molecular Characteristics | | Source | Neisseria meningitidis | | Alias Ids | 1.10.150.250, 5846, | Molecular Weight | 9793.83 Da. | | Residues | 82 | Isoelectric Point | 5.34 | | Sequence | mmvfddiakrkirfqtrrglleldlifgrfmekefehlsdkelsefseilefqdqellalinghsetdkg hlipmlekirra | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
