| Title | Solution Strucutre of the Hypothetical Staphylococcus Aureus protein SAV1430. Northest Strucutral Genomics Consortium target ZR18. To be Published | | Site | NESGC | | PDB Id | 1pqx | Target Id | ZR18 | | Related PDB Ids 2ffm | | Molecular Characteristics | | Source | Staphylococcus aureus | | Alias Ids | 3.30.1370.70, | Molecular Weight | 9406.15 Da. | | Residues | 83 | Isoelectric Point | 4.65 | | Sequence | mkiisisetpnhntmkitlsesregmtsdtytkvddsqpafindilkvegvksifhvmdfisvdkendan wetvlpkveavfe | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
