.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pm3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of the putative adapter protein MTH1859. J.Struct.Biol. 148 251-256 2004
    Site NESGC
    PDB Id 1pm3 Target Id TT431
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9205,2.30.30.240, PF05239 Molecular Weight 8240.23 Da.
    Residues 77 Isoelectric Point 4.87
    Sequence mriveemvgkevldssakvigkvkdvevdiesqaieslvlgkggiseglglskgetivpyemvkkigdk illkgpee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.15 Rfree 0.293
    Matthews' coefficent 5.20 Rfactor 0.255
    Waters Solvent Content 76.50

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch