| Title | Crystal structure of the putative adapter protein MTH1859. J.Struct.Biol. 148 251-256 2004 | | Site | NESGC | | PDB Id | 1pm3 | Target Id | TT431 | | Molecular Characteristics | | Source | Methanothermobacter thermautotrophicus | | Alias Ids | 2.30.30.240, | Molecular Weight | 8240.23 Da. | | Residues | 77 | Isoelectric Point | 4.87 | | Sequence | mriveemvgkevldssakvigkvkdvevdiesqaieslvlgkggiseglglskgetivpyemvkkigdki llkgpee | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 3.15 | Rfree | 0.293 | | Matthews' coefficent | 5.20 | Rfactor | 0.255 | | Waters | | Solvent Content | 76.50 |
| Ligand Information | | Ligands | | | Metals | | | |
