| Title | Crystal structure of RlmAI: implications for understanding the 23S rRNA G745/G748-methylation at the macrolide antibiotic-binding site. Proc.Natl.Acad.Sci.Usa 101 4041-4046 2004 | | Site | NESGC | | PDB Id | 1p91 | Target Id | ER19 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | 3.40.50.150, | Molecular Weight | 30417.27 Da. | | Residues | 269 | Isoelectric Point | 6.82 | | Sequence | msfscplchqplsreknsyicpqrhqfdmakegyvnllpvqhkrsrdpgdsaemmqarrafldaghyqpl rdaivaqlrerlddkatavldigcgegyythafadalpeittfgldvskvaikaaakrypqvtfcvass hrlpfsdtsmdaiiriyapckaeelarvvkpggwvitatpgprhlmelkgliynevhlhaphaeqlegf tlqqsaelcypmrlrgdeavallqmtpfawrakpevwqtlaakevfdcqtdfnihlwqrsy | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.80 | Rfree | 0.296 | | Matthews' coefficent | 3.81 | Rfactor | 0.248 | | Waters | 85 | Solvent Content | 67.68 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 5;SAM (S-ADENOSYLMETHIONINE) x 2 | | Metals | ZN (ZINC) x 2 | | |
