| Title | X-Ray Structure Of ElbB From E. Coli. Northeast Structural Genomics Research Consortium (Nesg) Target Er105. To be Published | | Site | NESGC | | PDB Id | 1oy1 | Target Id | ER105 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | 3.40.50.880, | Molecular Weight | 23325.64 Da. | | Residues | 220 | Isoelectric Point | 4.67 | | Sequence | mitmkkigvilsgcgvydgseiheavltllaisrsgaqavcfapdkqqvdvinhltgeamtetrnvliea aritrgeirplaqadaaeldalivpggfgaaknlsnfaslgsectvdrelkalaqamhqagkplgfmci apamlpkifdfplrltigtdidtaevleemgaehvpcpvddivvdednkivttpaymlaqniaeaasgi dklvsrvlvlae | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.95 | Rfree | 0.265 | | Matthews' coefficent | 2.38 | Rfactor | 0.216 | | Waters | 14 | Solvent Content | 47.93 |
| Ligand Information | | Ligands | | | Metals | | | |
