.
The Open Protein Structure Annotation Network
PDB Keyword
.

1on0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal Structure of Putative Acetyltransferase (YycN) from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 1on0 Target Id SR144
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9065,3.40.630.30, PF00583, PF08445 Molecular Weight 18163.92 Da.
    Residues 156 Isoelectric Point 6.71
    Sequence mtimltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhhlwslklne kdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmgirklslhvfahnqtark lyeqtgfqetdvvmskkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.289
    Matthews' coefficent 2.50 Rfactor 0.225
    Waters 357 Solvent Content 50.51

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch