| Title | Crystal Structure of Putative Acetyltransferase (YycN) from Bacillus subtilis. To be Published | | Site | NESGC | | PDB Id | 1on0 | Target Id | SR144 | | Molecular Characteristics | | Source | Bacillus subtilis | | Alias Ids | 3.40.630.30, | Molecular Weight | 18163.92 Da. | | Residues | 156 | Isoelectric Point | 6.71 | | Sequence | mtimltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhhlwslklnek divgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmgirklslhvfahnqtarkl yeqtgfqetdvvmskkl | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.20 | Rfree | 0.289 | | Matthews' coefficent | 2.50 | Rfactor | 0.225 | | Waters | 357 | Solvent Content | 50.51 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 4 | | Metals | CL (CHLORIDE) x 1 | | |