| Title | Crystal Structure of Polysaccharide Deacetylase (PDAA_BACSU) from B. Subtilis (Pdaa_Bacsu) Northeast Structural Genomics Research Consortium (Nesg) Target Sr127. To be Published | | Site | NESGC | | PDB Id | | Target Id | SR127 | | Molecular Characteristics | | Source | Bacillus subtilis | | Alias Ids | TPS9062,3.20.20.370, PF01522 | Molecular Weight | 30067.75 Da. | | Residues | 263 | Isoelectric Point | 7.15 | | Sequence | mkwmcsiccaavllaggaaqaeavpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiy ltfdngyengytpkvldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadq iqdeldsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkkyayd hmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekemrlpsl | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.80 | Rfree | 0.212 | | Matthews' coefficent | 2.41 | Rfactor | 0.182 | | Waters | 530 | Solvent Content | 49.00 |
| Ligand Information | | Ligands | | | Metals | | | |
