| Title | Functional assignment based on structural analysis: crystal structure of the yggJ protein (HI0303) of Haemophilus influenzae reveals an RNA methyltransferase with a deep trefoil knot. Proteins 53 329-332 2003 | | Site | NESGC | | PDB Id | 1nxz | Target Id | IR73 | | Molecular Characteristics | | Source | Haemophilus influenzae | | Alias Ids | 3.40.1280.10, 2.40.240.20, | Molecular Weight | 27371.15 Da. | | Residues | 245 | Isoelectric Point | 6.67 | | Sequence | mripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkksvkveilgre ladkeshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvkldaermdkkiqqwqkiaiaac eqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptipaggvrlligsegglsaqeiaqt eqqgfteillgkrvlrtetaslaaisalqicfgdlge | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.264 | | Matthews' coefficent | 2.23 | Rfactor | 0.214 | | Waters | 320 | Solvent Content | 44.94 |
| Ligand Information | | Ligands | | | Metals | | | |
