| Title | Solution structure of Vibrio cholerae protein VC0424: a variation of the ferredoxin-like fold. Protein Sci. 12 1556-1561 2003 | | Site | NESGC | | PDB Id | 1nxi | Target Id | OP3 | | Molecular Characteristics | | Source | Other | | Alias Ids | 3.30.70.970, 5589, | Molecular Weight | 14257.93 Da. | | Residues | 124 | Isoelectric Point | 3.98 | | Sequence | mshqddylsveelieiqkeetrdiiqalledgsdpdalyeiehhlfaedfdklekaaveafkmgfevlea eetededgnkllcfdatmqsaldaklideqveklvnlaekfdiiydgwgtyyeg | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
