| Title | Solution structure of Vibrio cholerae protein VC0424: a variation of the ferredoxin-like fold. Protein Sci. 12 1556-1561 2003 | | Site | NESGC | | PDB Id | | Target Id | OP3 | | Molecular Characteristics | | Source | Other | | Alias Ids | TPS8992,5589, PF06877, 3.30.70.970 | Molecular Weight | 14257.93 Da. | | Residues | 124 | Isoelectric Point | 3.98 | | Sequence | mshqddylsveelieiqkeetrdiiqalledgsdpdalyeiehhlfaedfdklekaaveafkmgfevle aeetededgnkllcfdatmqsaldaklideqveklvnlaekfdiiydgwgtyyeg | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
