| Title | X-RAY STRUCTURE OF MTH396. To be Published | | Site | NESGC | | PDB Id | 1nxh | Target Id | TT87 | | Molecular Characteristics | | Source | Methanothermobacter thermautotrophicus | | Alias Ids | 1.10.3070.10, | Molecular Weight | 14956.33 Da. | | Residues | 126 | Isoelectric Point | 4.75 | | Sequence | mdegelmrlmkrrilesyrwqedvvkplsreleidveefqdilmdkldmsslealhprfesarprcirek lhsdlqlcwlvdvmeiisvddaealkdeitelvlagreysealsegrrrlheilrs | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.80 | Rfree | 0.319 | | Matthews' coefficent | 2.81 | Rfactor | 0.226 | | Waters | | Solvent Content | 56.20 |
| Ligand Information | | Ligands | | | Metals | | | |
