| Title | NMR structure of the hypothetical protein AQ-1857 encoded by the Y157 gene from Aquifex aeolicus reveals a novel protein fold. Proteins 54 794-796 2004 | | Site | NESGC | | PDB Id | 1nwb | Target Id | QR6 | | Molecular Characteristics | | Source | Aquifex aeolicus | | Alias Ids | 2.60.300.12, 5683, | Molecular Weight | 12659.58 Da. | | Residues | 116 | Isoelectric Point | 4.33 | | Sequence | mqeqaqqfifkvtdkaveeikkvaqennienpilrirvvpggcsgfqyamgfddtveegdhvfeydgvkv vidpfsmpyvngaeldyvvdfmgggftirnpnatgscgcgssfscg | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
