.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ns5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Structure of YBEA from E. coli. To be Published
    Site NESGC
    PDB Id 1ns5 Target Id ER45
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8851,PF02590, 3.40.1280.10 Molecular Weight 17340.17 Da.
    Residues 155 Isoelectric Point 8.71
    Sequence mklqlvavgtkmpdwvqtgfteylrrfpkdmpfelieipagkrgknadikrildkegeqmlaaagknri vtldipgkpwdtpqlaaelerwkldgrdvslliggpeglspackaaaeqswslsaltlphplvrvlvae slyrawsittnhpyhre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.68 Rfree 0.213
    Matthews' coefficent 1.86 Rfactor 0.145
    Waters 409 Solvent Content 33.44

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch