| Title | High-quality homology models derived from NMR and X-ray structures of E. coli proteins YgdK and Suf E suggest that all members of the YgdK/Suf E protein family are enhancers of cysteine desulfurases. Protein Sci. 14 1597-1608 2005 | | Site | NESGC | | PDB Id | | Target Id | ER75 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS8864,3.90.1010.10, 5630, PF02657 | Molecular Weight | 15939.40 Da. | | Residues | 147 | Isoelectric Point | 6.11 | | Sequence | mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvwlgy tvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsasrsqglnalse aiiaatkqv | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
