| Title | Solution structure of hypothetical protein dimer encoded by the Yoag gene from Escherichia coli. To be published | | Site | NESGC | | PDB Id | | Target Id | ET94 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS8877,PF08956, 5621 | Molecular Weight | 6607.98 Da. | | Residues | 60 | Isoelectric Point | 4.14 | | Sequence | mgkatytvtvtnnsngvsvdyetetpmtllvpevaaevikdlvntvrsydtenehdvcgw | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 2 |
| Ligand Information | | Ligands | | | Metals | | | |
