.
The Open Protein Structure Annotation Network
PDB Keyword
.

1n91

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Resonance assignments for the hypothetical protein yggU from Escherichia coli. J.Biomol.Nmr 27 285-286 2003
    Site NESGC
    PDB Id 1n91 Target Id ER14
    Related PDB Ids 1yh5 
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS8832,3.30.1200.10, 5596, PF02594 Molecular Weight 10817.05 Da.
    Residues 100 Isoelectric Point 9.10
    Sequence mdgvmsavtvnddglvlrlyiqpkasrdsivglhgdevkvaitappvdgqanshlvkflgkqfrvaksq vviekgelgrhkqikiinpqqippevaalin
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch