| Title | A novel member of the split beta-alpha-beta fold: Solution structure of the hypothetical protein YML108W from Saccharomyces cerevisiae. Ontario Centre for Structural Proteomics target (YST0204_1_105); Northeast Structural Genomics Target (YT601). PROTEIN SCI. 12 1136-1140 2003 | | Site | NESGC | | PDB Id | 1n6z | Target Id | YT601 | | Molecular Characteristics | | Source | Saccharomyces cerevisiae | | Alias Ids | 3.10.20.250, 5568, | Molecular Weight | 12338.48 Da. | | Residues | 105 | Isoelectric Point | 4.51 | | Sequence | msksntyrmlvlleddtkinkedekflkgkpgkmhefvdelilpfnvdeldelntwfdkfdaeicipneg hikyeissdglivlmldkeieevvekvkkfveenn | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |