.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mzh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal Structure of Aquifex Aeolicus Aldolase, Northeast Structural Genomics Consortium Target QR15. To be Published
    Site NESGC
    PDB Id 1mzh Target Id QR15
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS9039,PF01791, 3.20.20.70 Molecular Weight 24180.72 Da.
    Residues 219 Isoelectric Point 6.17
    Sequence midvrkyidnaalkphlsekeieefvlkseelgiyavcvnpyhvklassiakkvkvccvigfplglnkt svkvkeaveavrdgaqeldivwnlsafksekydfvveelkeifretpsavhkvivetpylneeeikkav eicieagadfiktstgfaprgttleevrlikssakgrikvkasggirdletaismieagadrigtssgi siaeeflkrhli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.277
    Matthews' coefficent 2.30 Rfactor 0.223
    Waters 391 Solvent Content 46.54

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch