| Title | The SufE sulfur-acceptor protein contains a conserved core structure that mediates interdomain interactions in a variety of redox protein complexes. J.Mol.Biol. 344 549-565 2004 | | Site | NESGC | | PDB Id | | Target Id | ER30 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS8840,3.90.1010.10, PF02657 | Molecular Weight | 15799.47 Da. | | Residues | 138 | Isoelectric Point | 5.84 | | Sequence | mallpdkekllrnflrcanweekylyiielgqrlpelrdedrspqnsiqgcqsqvwivmrqnaqgiiel qgdsdaaivkgliavvfilydqmtpqdivnfdvrpwfekmaltqhltpsrsqgleamirairakaaals | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.251 | | Matthews' coefficent | 2.02 | Rfactor | 0.208 | | Waters | 185 | Solvent Content | 39.17 |
| Ligand Information | | Ligands | | | Metals | | | |
