.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mi1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of the BEACH domain reveals an unusual fold and extensive association with a novel PH domain. EMBO J. 21 4785-4795 2002
    Site NESGC
    PDB Id 1mi1 Target Id HC3
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8905,2.30.29.40, PF02138, 1.10.1540.10 Molecular Weight 46741.04 Da.
    Residues 406 Isoelectric Point 5.53
    Sequence gpvvlstpaqliapvvvakgtlsittteiyfevdeddsafkkidtkvlayteglhgkwfseiravfsrr yllqntalevfanrtsvfnfpdqatvkkvvyslprvgvgtsyglpqarrislatprqlykssntqrwqr reisnfeylflntiagrtyndlnqypvfpwvltnyeseeldltlpgnfrdlskpigalnpkravfyaer yetweddqsppyhynthystatstlswlvriepfttfflnandgkfdhpdrtfssvarswrtsqrdtsd vkelipefyylpefvnsngynlgvredevvvndvdlppwakkpedfvrinralesefvscqlhqwidli fgykqrgpeavralnvfhyltyegsvnldsitdpvlreaeaqiqnfgqtpsqlliephppr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.2640000
    Matthews' coefficent 4.77 Rfactor 0.2300000
    Waters Solvent Content 74.22

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch