| Title | Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1. J.STRUCT.FUNCT.GENOM. 4 25-30 2003 | | Site | NESGC | | PDB Id | | Target Id | YTYst190 | | Molecular Characteristics | | Source | Saccharomyces cerevisiae | | Alias Ids | TPS9265,PF00240, 5481, 3.10.20.90 | Molecular Weight | 8271.18 Da. | | Residues | 73 | Isoelectric Point | 6.05 | | Sequence | mievvvndrlgkkvrvkclaedsvgdfkkvlslqigtqpnkivlqkggsvlkdhisledyevhdqtnle lyyl | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |