| Title | Solution Structure of the Yeast Ubiquitin-Like Modifier Protein Hub1. J.Struct.Funct.Genomics 4 25-30 2003 | | Site | NESGC | | PDB Id | 1m94 | Target Id | YTYst190 | | Molecular Characteristics | | Source | Saccharomyces cerevisiae | | Alias Ids | 3.10.20.90, 5481, | Molecular Weight | 8271.18 Da. | | Residues | 73 | Isoelectric Point | 6.05 | | Sequence | mievvvndrlgkkvrvkclaedsvgdfkkvlslqigtqpnkivlqkggsvlkdhisledyevhdqtnlel yyl | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |