| Title | Crystal structure of a C.elegans MSP family member. To be Published | | Site | NESGC | | PDB Id | | Target Id | WR4 | | Molecular Characteristics | | Source | Caenorhabditis elegans | | Alias Ids | TPS9246,2.60.40.360, PF00635 | Molecular Weight | 11608.49 Da. | | Residues | 107 | Isoelectric Point | 6.73 | | Sequence | minvdpptgnypatggnsthnitsesdsrlafkvkssnnehyrvrpvygfvdakgkskldinrlpgppk edkiviqyaevpaeetdpmapfkagaqqgeiivkliaa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.80 | Rfree | 0.2927 | | Matthews' coefficent | | Rfactor | 0.278 | | Waters | 90 | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
