| Title | Crystal Structures of MTH1187 and its Yeast Ortholog YBL001C. Proteins 52 478-480 2003 | | Site | NESGC | | PDB Id | | Target Id | TT272 | | Molecular Characteristics | | Source | Methanothermobacter thermautotrophicus | | Alias Ids | TPS9203,3.30.70.930, PF01910 | Molecular Weight | 10797.72 Da. | | Residues | 99 | Isoelectric Point | 4.84 | | Sequence | mitaeltviplgtcstslssyvaaavealkklnvryeisgmgtlleaedldelmeavkaaheavlqags drvyttlkiddrrdadrglrdkvesvkeki | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.30 | Rfree | 0.245 | | Matthews' coefficent | | Rfactor | 0.216 | | Waters | 139 | Solvent Content | |
| Ligand Information | | Ligands | SO4 (SULFATE) x 6 | | Metals | | | |
