.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lxj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title CRYSTAL STRUCTURES OF MTH1187 AND ITS YEAST ORTHOLOG YBL001C. Proteins 52 478-480 2003
    Site NESGC
    PDB Id 1lxj Target Id YTYst72
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS9268,3.30.70.930, PF01910 Molecular Weight 11517.66 Da.
    Residues 104 Isoelectric Point 6.17
    Sequence mpkifcladvcmvpigtdsasisdfvaliekkiresplkstlhsagttiegpwddvmgligeiheyghe kgyvrvhtdirvgtrtdkhqtaqdkidvvlkkisq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.243
    Matthews' coefficent 3.25 Rfactor 0.211
    Waters 223 Solvent Content 62.10

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch