| Title | NMR structure of the Escherichia coli protein YacG: a novel sequence motif in the zinc-finger family of proteins. Proteins 49 289-293 2002 | | Site | NESGC | | PDB Id | | Target Id | ET92 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS8875,PF03884, 3.30.50.10, 5335 | Molecular Weight | 7305.77 Da. | | Residues | 65 | Isoelectric Point | 4.49 | | Sequence | msetitvncptcgktvvwgeispfrpfcskrcqlidlgewaaeekripssgdlsesddwseepkq | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 1 | | |
