| Title | Crystal Structure of the GalM/aldose Epimerase Homologue from C. elegans, Northeast Structural Genomics Target WR66. TO BE PUBLISHED | | Site | NESGC | | PDB Id | | Target Id | WR66 | | Molecular Characteristics | | Source | Caenorhabditis elegans | | Alias Ids | TPS9249,PF01263, 2.70.98.10 | Molecular Weight | 36584.86 Da. | | Residues | 330 | Isoelectric Point | 5.34 | | Sequence | masgfieiankqgltatllpfgatlakltfpdkngknqdlvlgfdtidefekdaasigktvgrvanrik nstlhfdgkqytmtpnngphylhggpnglgyrkwevvrhapesvsfsvraneqddglpgdakidvtytv ndrnqliiehhatcdtpgllaltnhaywnldgsdtvaehflemeadefvevddtfcptgairsvtdtgf dfrsgkqlkesgkdaeelldldndlvitkktppstpstylrfwseksgielsittsypvihlyaskfld ckgkkgehykankalaiepqfhsaapnfdhfpdvslrpgdhycqeivytfshvn | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.85 | Rfree | 0.262 | | Matthews' coefficent | 2.50 | Rfactor | 0.224 | | Waters | 398 | Solvent Content | 50.88 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 2 | | Metals | | | |
