| Title | Solution Structure of Hypothetical Protein tm1112. to be published | | Site | NESGC | | PDB Id | | Target Id | VT74 | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS9225,2.60.120.280, PF05899, 5357, PF07883, PF06249, 2.60.120.10 | Molecular Weight | 10756.93 Da. | | Residues | 89 | Isoelectric Point | 5.50 | | Sequence | mevkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyviekgdlvtfp kglrcrwkvlepvrkhynlf | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
